<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-01921 EHR-01921 Cyprus 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15V, G16E, L19P, K20I, E35N, M36I, R41K, K45R, R57K, L63S, H69K, K70R, L89M  
>EHR-01921| codons 1-99
PQITLWQRPIVTVRVEGQPIEALLDTGADDTVLENINLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D123N, I135T, N147ND, E169D, F171Y, K173A, Q174K, D177E, V179I, T200A, I202V, Q207DE, R211K, V245E  
>EHR-01921| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYDVLPQGWKGSPAIFQSSMTKILDPYRAKNPEIII
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013