<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-01797 EHR-01797 Spain 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, M36I, N37D, I62IV, L63H, I64L, A71V, I72T, I93L  
>EHR-01797| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYDQVH
LEICGHKVTGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215E     V35L, E36N, I37F, S48T, A98S, K122E, D123E, I135T, D177E, I178M, I202V, V245E  
>EHR-01797| codons 35-247
LNFCTEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPSGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGF
ETPDKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013