<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-00912 EHR-00912 Romania 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15IV, G16E, K20R, E35D, M36I, R41K, R57K, L63T, E65D, L89M  
>EHR-00912| codons 1-99
PQITLWQRPVVTVKVEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, D123E, I135L, S162H, F171L, K173T, Q174K, D177G, T200A, Q207E, R211K, V245Q T7TNS
>EHR-00912| codons 1-246
PISPIESVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPLRTKNPGIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQL

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013