<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-00383 EHR-00383 Germany 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, G16GE, G17GE, K20R, E35D, M36I, R41K, I62V, L63A, H69Q, L89M  
>EHR-00383| codons 1-99
PQITLWQRPVVTIKVEEQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVAIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, D123E, A158AS, I159IV, K173T, Q174K, D177E, Q207E, P243A, V245Q  
>EHR-00383| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSVFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013