<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DK-2715 DK-2715 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ IDV+ RTI 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A, N88S, L90M L33F, Q58E, G73TS L10I, I13V, K55KR, I62IV, L63P, A71V, V77I  
>DK-2715| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFVRVREYD
QVPIEICGHKVITTVLIGPTPANIIGRSLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M   A98G T39E, K43KE, E44D, E79D, K103R, V118I, K122E, I142V, K173E, G196GE, H208Y, R211K, Q278H, T286A  
>DK-2715| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRDLNKRTQDFWEVQLGIPHPGGLKKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001