<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DK-2314 DK-2314 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ RTI 133

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S, L90M   L10IM, I13V, Q18H, N37D, K55KR, Q61QH, L63P, A71T, I72T, V77I, I93L  
>DK-2314| codons 1-99
PQITLWQRPIVTVKIGGHLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIRVRQYD
HIPIEICGHKTTGTVLIGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, M184V, T215Y V75A K103N, G190GC   K73M, R83K, L100X, K101KQ, V118I, D123G, I135IM, S162X, I178L, T286A, I293V, E297A, D324E, R358K  
>DK-2314| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRMVADFRELNKKTQDFWEVQLGIPHPAGXQKNKSVTVLDVGDAYFSIPL
DKGFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRKQNPDLVI
YQYVDDLYVCSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001
Mo, H Selection of resistance in protease inhibitor-experienced, human immunodeficiency virus type 1-infected subjects failing lopinavir- and ritonavir-based therapy: mutation patterns and baseline correlates. J Virol, 2005
King, M Phenotypic susceptibility to TMC-114 and tipranavir before and after lopinavir/ritonavir-based treatment in subjects demonstrating evolution of lopinavir resistance. IHDRW 2006, 2006