<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DK-1704 DK-1704 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ RTI 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82F   E35D, M36I, N37D, R41K, R57K, L63P, V77I, I93L  
>DK-1704| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPFNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215VF K219Q     K20R, K104N, I167V, I202V, R211K, V245K, A288K, V292I, I293V, D324E, M357T, A400IV  
>DK-1704| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKKLTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003