<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR_97ZA012 CR_97ZA012 South Africa 1997 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37D, K43R, L63P, H69K, L89M, I93L  
>CR_97ZA012| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIDLPGRWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, D123S, K173A, Q174K, D177E, T200A, E204D, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, E300K, I326V, Q334D, G335D, R356K, G359T, T377L, K390R, E399D, A400I, E404D, V435A, G436E, E449D, L452K, V466I, T470N, D471E, T477A, H483Q, S519N, E523G, K530R, V531I, A534S, A554S  
>CR_97ZA012| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEDLRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAK
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGDDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWDIWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAEAETFYVDGAANRDTKKGKAGYVTDRGRQKIVSLNETTNQKAELQ
AIQLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIGQLIKKERIYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rodenburg, CM Near full-length clones and reference sequences for subtype C isolates of HIV type 1 from three different continents. ARHR, 2001