<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, V106I, K122E, I142IM, S162ST, K166KR, I178M, Q197P, A272P, E297A, S322T, I329V, G333D  
>CV1320_102| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGMRYQYNVLPQGWKGSPAIFQTSMTRILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGPHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPTKDLIAEVQKQDQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19LQ, K43KR, Q61D, L63P, E65D  
>CV1320_102| codons 1-99
PQITLWQRPLVTIKIGGQQKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
DIPIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013