<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CV1320_102 CV1320_102 Italy 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, V106I, K122E, I142IM, S162ST, K166KR, I178M, Q197P, A272P, E297A, S322T, I329V, G333D  
>CV1320_102| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGMRYQYNVLPQGWKGSPAIFQTSMTRILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGPHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPTKDLIAEVQKQDQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19LQ, K43KR, Q61D, L63P, E65D  
>CV1320_102| codons 1-99
PQITLWQRPLVTIKIGGQQKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
DIPIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013