<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     K11T, T27P, V35I, E36D, T39E, I50V, D121H, K122E, D123S, K166R, K173I, Q174K, D177E, I178L, T200A, Q207A, R211S, E248D, A272P, K277R, T286A, E291D, V292I, I293V, P294T  
>20MOS| codons 1-320
PISPIETVPVTLKPGMDGPKVKQWPLPEEKIKALIDICEEMEKEGKISKVGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, M36I, R41K, L63P, H69Q, I72IV, V77I, L89M, I93IL  
>20MOS| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Selimova, LM HIV-1 pol gene subtypes isolated from drug-naive individuals in Russia. Direct Genbank Submission, 2010