<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, E35D, M36I, R41K, R57K, L63T, E65D, I72T, T74S, L89M V56G, A71N
>SR66| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKGKQYD
QITIDICGHKNTGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, T39A, K65E, D123E, I135L, S162A, K173T, Q174R, T200A, Q207E, R211K, V245Q, E248D, A272P, E291D, V292I, I293V, E297A, D324E, I326V, I329V V35L_A
>SR66| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALLEICAEMEKEGKISKIGPENPYNTPV
FAIKEKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELVAEVQKQGQG

References
Author Title Citation
Temereanca, A Transmitted HIV drug resistance in newly diagnosed, treatment-naive Romanian patients. J Med Virol, 2013