<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SR31 SR31 Romania 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, E35G, M36I, R41K, I64V, H69K  
>SR31| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, S68T, K122E, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, P243H, V245E, K275R, V276I, T286A, E291D, V292I, I293V, P294T, S322T, I326V I132Y
>SR31| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDTTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTYPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQHIELPEKDSWTVNDIQKLVGKLNWASQIYAGIRIKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQG

References
Author Title Citation
Temereanca, A Transmitted HIV drug resistance in newly diagnosed, treatment-naive Romanian patients. J Med Virol, 2013