<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MC97GH23 MC97GH23 Ghana 1997 HIV1 CRF02_AG Serum None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2X, I13V, K14R, K20I, E35N, M36I, N37D, R41K, H69K, K70R, L89M  
>MC97GH23| codons 1-99
PXITLWQRPLVTVRIGGQLIEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49R, V60I, L109X, K122E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207D, R211K, V245Q, T286A  
>MC97GH23| codons 1-289
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVXDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKAL

References
Author Title Citation
Cornelissen, M Spread of distinct human immunodeficiency virus type 1 AG recombinant lineages in Africa. J Gen Virol, 2000