<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Gab082017 Gab082017 Gabon 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, K14R, G16E, K20I, M36I, P39L, R41K, K43R, I62V, H69K, L89M  
>Gab082017| codons 1-99
PQITLWQRPLVSVRIEGQLIEALLDTGADDTVLEEINLLGKWRPKMIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     V35T, E36D, T39L, K122E, D123N, K173S, T200A, Q207E, L210M, V245Q, D250G  
>Gab082017| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICLEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLMRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKGSWTVNDIQ

References
Author Title Citation
Caron, M Prevalence, genetic diversity and antiretroviral drugs resistance-associated mutations among untreated HIV-1-infected pregnant women in Gabon, central Africa. BMC Infect Dis, 2012