<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MC93GH05 MC93GH05 Ghana 1993 HIV1 CRF02_AG Serum None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, N37D, G40X, R41K, L63V, G68E, H69K, K70R, L89I, T91V, I93L  
>MC93GH05| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDIDLPXKWKPKMIGGIGGFIKVRQYD
QIVIEICEKRAIGTVLVGPTPVNIIGRNILVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, V60I, V90I, I135V, S162A, K173T, Q174E, D177E, I178M, T200A, E204K, Q207E, P243T, V245Q, K277R, T286A  
>MC93GH05| codons 1-289
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEMVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKAL

References
Author Title Citation
Cornelissen, M Spread of distinct human immunodeficiency virus type 1 AG recombinant lineages in Africa. J Gen Virol, 2000