<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV61 AV61 Nigeria 1996 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R41K, H69K, V82I, L89M  
>AV61| codons 9-92
PLVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICG
KKAIGTVLVGPTPINIIGRNMLTQ

References
Author Title Citation
Vicente, AC Genetic variability of HIV-1 protease from Nigeria and correlation with protease inhibitors drug resistance. Virus Genes, 2001