<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AV65 AV65 Nigeria 1996 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, N37D, R41K, R57K, L63P, C67E, H69K, V82I, L89M, Q92L  
>AV65| codons 12-92
TVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYDQIPIEIEGKKA
IGTVLVGPTPINIIGRNMLTL

References
Author Title Citation
Vicente, AC Genetic variability of HIV-1 protease from Nigeria and correlation with protease inhibitors drug resistance. Virus Genes, 2001