<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JN_IC0068 JN_IC0068 Cote d'Ivoire 1997 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, L38M, R41K, R57K, Q61N, L63P, I64V  
>JN_IC0068| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINMPGKWKPKMIGGIGGFIKVKQYD
NIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Nkengasong, JN Distribution of HIV-1 subtypes among HIV-seropositive patients in the interior of Cote d'Ivoire. JAIDS, 2000