<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JN_IC28 JN_IC28 Cote d'Ivoire 1997 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, K20I, M36L, L38F, R41K, L63P, H69K, L89M  
>JN_IC28| codons 1-99
PQITLWQRPLVTVKIGGQIIEALLDTGADDTVLEELNFPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Nkengasong, JN Distribution of HIV-1 subtypes among HIV-seropositive patients in the interior of Cote d'Ivoire. JAIDS, 2000