<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SM29 SM29 Argentina 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI+ NNRTI+ PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39T, K45R, L63P, A71T, T96S  
>SM29| codons 21-99
EALLDTGADDTVLEEMNLTGRWKPRMIGGIGGFIKVRQYDQIPIEICGHKTIGTVLVGPT
PVNIIGRNLLTQIGCSLNF

References
Author Title Citation
Masciotra, S Evidence of a high frequency of HIV-1 subtype F infections in a heterosexual population in Buenos Aires, Argentina. ARHR, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005