<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SM33 SM33_6 Argentina 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI+ NNRTI+ PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V   E35D, D60E, L63P, A71T, V77I, T96S  
>SM33_6| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIVGIGGFIKVRQYE
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCSLNF

References
Author Title Citation
Masciotra, S Evidence of a high frequency of HIV-1 subtype F infections in a heterosexual population in Buenos Aires, Argentina. ARHR, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005