Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SM7 | SM7 | Argentina | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | RTI+ NNRTI+ PI | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32E, G73S | L10I, I15V, E35D, M36I, N37S, R41K, L63P, A71V, I85V, T96S |
| >SM7| codons 1-99 PQITLWQRPIVTIKVGGQLKEALLDTGADDTELEDISLPGKWKPKMIGGIGGFIKVRQYD QIPIEICGHKVISTVLVGPTPVNIVGRNLLTQIGCSLNF |
References
| Author | Title | Citation |
| Masciotra, S | Evidence of a high frequency of HIV-1 subtype F infections in a heterosexual population in Buenos Aires, Argentina. | ARHR, 2000 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |