<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SM3 SM3 Argentina 1997 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 RTI+ NNRTI+ PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, M36I, R41K, R57K, Q61N, L63I, T96S  
>SM3| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCSLNF

References
Author Title Citation
Masciotra, S Evidence of a high frequency of HIV-1 subtype F infections in a heterosexual population in Buenos Aires, Argentina. ARHR, 2000