<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I Q2*, L5LF, I15L, T31TP, Y59YF, L63P, I93L  
>7| codons 1-99
P*ITFWQRPLVTIKLGGQLKEALLDTGADDPVIEEMNLPGRWKPKMIGGIGGFIKVRQFD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, K101R, I135L, K166R, K173N, A272P, P345S, V435A, D460N, R461K, S468N, L491S, E516G, S519N, A554T  
>7| codons 1-558
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRNQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQESFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTNKGRQKVVNLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESGLVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRK

References
Author Title Citation
Pariente, N Long-term suppression of plasma viremia with highly active antiretroviral therapy despite virus evolution and very limited selection of drug-resistant genotypes. J Med Virol, 2004