<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4700_2007 4700_2007 Romania 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, G16E, E35D, M36I, P39S, R41K, R57K, L63T, E65D, I72T, L89M, L97F  
>4700_2007| codons 1-99
PQITLWQRPVVTVKVEGQLKEALLDTGADDTVLEDINLSGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTFNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, E44X, D123E, I135L, S162H, E169EG, K173T, Q174K, I178L, T200A, Q207E, R211K, V245Q, E248D, A272P, V292I, P294T, E297A  
>4700_2007| codons 1-310
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKXGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILGPFRTKNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIITLTAEAE
LELAENREIL

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011