<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4650_2007 4650_2007 Romania 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, E35D, M36I, R41K, R57K, L63T, E65D, I72V, T74S, L89M  
>4650_2007| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKAVGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, I135L, S162H, K173T, Q174K, T200EK, Q207A, R211K, V245Q, A272P, I293V, P294T, E297A, Q330P  
>4650_2007| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRKKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVTLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIPKQGQG

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011