<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4642_2007 4642_2007 Romania 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16GE, L19I, E35D, M36I, R41K, R57K, L63T, E65D, T74S, L89M  
>4642_2007| codons 1-99
PQITLWQRPLVTIKVEGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T7S, V35T, T39A, E40D, D123E, I135L, E138G, F171Y, K173T, Q174K, T200E, Q207A, R211K, V245Q, E248N, A272P, V276I, T286A, A288T, E291D, V292I, I293V, E297A, A304E R143RG
>4642_2007| codons 1-319
PISPIESVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNGTPGIGYQYNVLPQGWKGSPAIFQSSMTKILEPYRTKNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGAKTLTDIVPLTAEAE
LELEENREILKEPVHGVYY

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011