<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3160_2007 3160_2007 Romania 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TKPQ, I15IV, G16GE, L19LI, E35D, M36I, R41K, K45KR, R57K, I62V, L63T, E65D, I72IT, V82I, L89M  
>3160_2007| codons 1-99
PQITLWQRPLVQIKVEGQIKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QVTIDICGHKATGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, D123E, I135L, S162H, K173T, Q174K, I195L, T200AE, Q207A, R211K, V245Q, E248DN, A272P, V276I, L283LI, T286TA, E291ED, V292I, I293V, P294T, E297A, V317A  
>3160_2007| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLELGQHREKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGAKALTDIVTLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011