<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3016_2007 3016_2007 Romania 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215S     K32I, V35T, V60I, D123E, E138A, S162C, K173A, Q174K, D177E, V179I, T200AE, I202V, Q207A, R211K, V245Q, E248N, A272P, T286A, E291D, V292I, I293V, E297AP, I309L, I329V  
>3016_2007| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIII
YQYMDDLYVGSDLEIGQHREKVEELRAHLLKWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTPEAE
LELAENRELLKEPVHGVYYDPSKDLIAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, G16E, L19LI, E35D, M36I, R41K, R57K, L63T, E65D, I72T, L89LM  
>3016_2007| codons 1-99
PQITLWQRPIVTIKIEGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011