<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2360_2008 2360_2008 Romania 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, L89M  
>2360_2008| codons 1-99
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49KR, V60I, D123E, I135L, S162C, K173E, Q174K, T200TA, Q207A, R211K, L228Q, V245Q, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D324E, I329L  
>2360_2008| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFREKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFQWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGQG

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011