<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20KR, E35D, M36I, R41K, I62IV, L63T, I64ILM, E65D, I72IT, V82VI, L89M  
>1679_2007| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVTMDICGHKATGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K20R, V35T, T39A, E40ED, D123E, I135L, S162H, K166KR, K173AITV, Q174KR, N175Y, T200AE, Q207T, R211T, I244IMV, V245Q, E248D, A272P, T286TA, E291ED, V292VI, I293V, P294T, L295M, E297AT, V317VA, Q334H  
>1679_2007| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTRILEPFRVRYPDIDI
YQYMDDLYVGSDLEIGQHREKIEELRTHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTMTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGHG

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011