<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
102_2008 102_2008 Romania 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, T74S, L89M  
>102_2008| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, D123E, S134R, I135L, S162Y, S163T, K173T, Q174K, T200A, Q207T, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, P294T, E297A Y146D, I293M
>102_2008| codons 15-300
GMDGPKVKQWPLTEEKIKALVEICADMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKL
VDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPR
LNNETPGIRYQDNVLPQGWKGSPAIFQYTMTKILEPFRTKNPDIVIYQYMDDLYVGSDLE
IGQHRAKIEELRTHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPDKDSWTV
NDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIMTLTAEAE

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011