<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, T74S, L89M  
>100_2008| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, D121HY, K122E, D123E, I135L, S162H, K173T, Q174N, D177G, T200A, Q207K, R211K, F214L, V245Q, E248D, A272P, T286V, E291D, V292I, I293V, P294T, E297A  
>100_2008| codons 1-325
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTNNPGIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGVKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPSKDL

References
Author Title Citation
Florea, D HIV transmitted drug resistance in Romania 2007-2010 Direct Genbank Submission, 2011