<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC12 AC12 Vietnam 1998 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, L38V, R41K, Q61N, L63Q  
>AC12| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDVPGKWKPKMIGGIGGFIKVRQYD
NIQIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, D121Y, K122E, I159V, E169EK, K173N, Q174K, D177E, Q207E, R211K, F214L, V245E  
>AC12| codons 7-249
TVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPIFAIKKK
DSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRK
YTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQSSMTKILKPFRNKNPEIVIYQYMDD
LYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIEL
PEK

References
Author Title Citation
Caumont, A Sequence analysis of env C2/V3, gag p17/p24, and pol protease regions of 25 HIV type 1 isolates from Ho Chi Minh city, Vietnam. ARHR, 2001