<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
WJ_VI1197 WJ_VI1197 Belgium 1994 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 AZT 166

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, K219Q     K20R, V35T, V60I, T69N, K103R, K122E, D123S, S162A, K173T, Q174E, D177K, T200A, E203D, Q207E, F214L, V245Q, K275R, T286A, E291D, V292I, I293V, P294T, S322G, D324E, G335D, R356K, M357R, R358K, G359S, T369V, A371V, I375V, I380V, K390R, K395R, T403R, E432D, V435A, V466A, D471E, Q480H, H483Q, L491S, K512R, S519N, Q524K, K527E, E529D, L533V, A534S, A554S  
>WJ_VI1197| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPKIVI
YQYMDDLYVGSDLEIGQHRAKIDELREHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPGKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRKSA
HTNDVKQLVEVVQKVATESVVIWGKTPKFRLPIQRETWEAWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKAVSLTETTNQKTELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKDKVYVSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E34A, M36I, N37S, R41K, H69K, L89M  
>WJ_VI1197| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLAEISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Janssens, W Near full-length genome analysis of HIV type 1 CRF02.AG subtype C and CRF02.AG subtype G recombinants. ARHR, 2000