<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP57-289976 SP57-289976 Spain 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I T12X, N37T, P39S, L63P, A71V, I72IT, V77I, I93L  
>SP57-289976| codons 4-99
TLWQRPLVXIKIGGQLKEALLDTGADDTVIEEMTLSGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Holguin, A Increase of non-B subtypes and recombinants among newly diagnosed HIV-1 native Spaniards and immigrants in Spain. Curr HIV Res, 2008