<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP33-302390 SP33-302390 Spain 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, S68G, D123E, I135T, I195L, T200A, R211T, A272P, T286A, A288AT, E297R, K311R, S322T, I329IV, G333D, Q334N  
>SP33-302390| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLELGQHRAKIEELRQHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTEVIPLTREAE
LELAENREILREPVHGVYYDPTKDLIAEVQKQDNG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, R57K, D60E, Q61E, I62V, L63P, C67Y, A71T, I72V, V77I, I93L  
>SP33-302390| codons 1-99
PQITLWQRPLVPIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYE
EVPIEIYGHKTVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Holguin, A Increase of non-B subtypes and recombinants among newly diagnosed HIV-1 native Spaniards and immigrants in Spain. Curr HIV Res, 2008