<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP17-315292 SP17-315292 Spain 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, I13V, K14R, I15IV, K20I, E35Q, M36I, R41K, R57K, C67E, H69K, V82I, L89M  
>SP17-315292| codons 4-98
TLWQRPMVTVRVGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYDQIL
IEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I37X, K49R, I50V, V60I, K104KR, D121Y, K122E, I135M, S162C, K173T, Q174K, D177X, I178L, I195L, T200A, Q207E, R211K, V245Q  
>SP17-315292| codons 37-247
XCTEMEKEGKISRVGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKRSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGS
PAIFQCSMTKILEPFRTKNPXLVIYQYMDDLYVGSDLELGQHRAKIEELREHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Holguin, A Increase of non-B subtypes and recombinants among newly diagnosed HIV-1 native Spaniards and immigrants in Spain. Curr HIV Res, 2008