<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M62 M62 France 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19Q, M36I, N37R, R41N, Q61N, L63A, H69K, V82I, L89M, I93L  
>M62| codons 1-99
PQITLWQRPLVSIKVEGQQKEALLDTGADDTVLEEIRLPGNWKPKMIGGIGGFIKVRQYD
NIAIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: how to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001