<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LN171 LN171 China 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, K82R, V118I, D123N, I135T, K173I, Q174K, D177E, G196R, T200I, I202V, Q207A, R211S, F214L, K238R, V245K, V276I  
>LN171| codons 1-280
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIRQHRIKVEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLC

References
Author Title Citation
Han, X Genetic and epidemiologic characterization of HIV-1 infection In Liaoning Province, China. JAIDS, 2010