<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M44 M44 France 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V   K103N K238N K20R, V35T, T39S, V90I, K122E, S162Y, E169D, K173A, Q174K, Q207N, R211K, D237E P52PL
>M44| codons 16-239
MDGPRVKQWPLTEEKIKALTEICSELEKEGKISKIGLENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVIYQYVDDLYVGSDLEI
GQHRTKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPENW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14Q, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, E65Q, L89M  
>M44| codons 1-99
PQITLWQRPLVTIQVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NVLIQICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001