<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M43 M43 France 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K32I, V35T, K49R, D123E, I135T, S162C, E169D, K173A, Q174R, D177E, Q207E, R211K  
>M43| codons 16-239
MDGPKVKQWPLTEEKIIALTEICTELEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPST
NNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRARNPEIVIYQYMDDLYVGSDLEI
GQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61H, I72V, L89M, I93L  
>M43| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
HILIEICGHKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001