<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M40 M40 France 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ ABC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39A, E40D, K49R, V60I, D121Y, K122E, I142V, S162A, E169D, D177E, E203EK, Q207E, R211K I63IL
>M40| codons 16-239
MDGPKVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPIFALKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSI
NNETPGVRYQYNVLPQGWKGSPAIFQASMTKILDPFRKQNPEIVIYQYVDDLYVGSDLEI
GQHRTKIKELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57RK, L63P, I64V, I93L  
>M40| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001