<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M39 M39 France 1999 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ NVP+ ABC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   G16E, K20M, M36I, P39Q, R41K, L63R, I64V  
>M39| codons 1-99
PQITLWQRPLVTIKIEGQLMEALLDTGADDTVLEEINLQGKWKPKIIGGIGGFVKVRQYD
QIRVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LV   K103KN, Y181YC   K20R, V35T, E40D, K49R, V60I, V90VI, K122E, S162A, E203K, Q207E, K219G, H221HY  
>M39| codons 16-239
MDGPRVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPIFAIKKKNSTRWRKVV
DFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVICQYMDDLYVGSDLEI
GQHRTKIKELREHLLRWGFTTPDGKYQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001