<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L L33I I13V, E35D, M36I, P39S, R41K, R57K, H69K, L89M  
>SP99-396546| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVIEDINLSGKWKPKLIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V21I, K32R, V35I, T39N, V60I, D123S, I135T, K173L, Q174K, D177G, V179I, I202V, Q207D, R211K, V245Q, E248N, V276I, T286A, E291D, I293V, P294T, E312D  
>SP99-396546| codons 1-335
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIRALIEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPGIII
YQYMDDLYVGSDLEIGQHRTKVEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Yebra, G Clinical differences and viral diversity between newly HIV type 1-diagnosed African and non-African patients in Spain (2005-2007). ARHR, 2009