<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP81-385167 SP81-385167 Spain 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19P, K20I, M36I, N37D, L63S, I64M, H69K, L89M  
>SP81-385167| codons 4-99
TLWQRPLVTVKIGGQPIEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYDQIS
MEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39L, K122E, D123N, S162A, K173E, Q174D, D177E, T200A, Q207E, R211RK, V245Q  
>SP81-385167| codons 38-247
CLEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFREDNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Yebra, G Clinical differences and viral diversity between newly HIV type 1-diagnosed African and non-African patients in Spain (2005-2007). ARHR, 2009