<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M36 M36 France 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16A, E35D, M36I, R41K, H69K, L89M  
>M36| codons 1-99
PQITLWQRPLVTIKIAGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, D123S, E169ED, K173A, Q174K, D177E, Q207A, R211S  
>M36| codons 16-239
MDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEIVIYQYMDDLYVGSDLEI
GQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001