<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M35 M35 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NFV+ NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, I13V, K14R, G16E, K20I, E35DN, M36I, I62IV, L63S, C67D, H69R, I72T, L89M, I93IM  
>M35| codons 1-99
PQITLWQRPIVTVRIEGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVSIEIDGRKATGTVLVGPTPVNIIGRNMMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75T K70N Y181C V108I K20R, V35T, T39N, K104R, K122E, D123S, I135V, T139A, K173A, Q174K, D177E, Q207A, R211S, H221HY  
>M35| codons 16-239
MDGPRVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPVFAIKKKDSTNWRKLT
DFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTILDVGDAYFSVPLDESFRKYTAFTIPSV
NNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVICQYMDDLYVGSDLEI
GQHRTKIEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001