<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M32 M32 France 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V       V21I, V35T, T39A, K126KR, I135IV, I142V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, F214L  
>M32| codons 16-239
MDGPKIKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRRYTAFTIPSV
NNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVIYQYVDDLYVGSDLEI
GQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36I, R41K, L63X, H69Q, L89M  
>M32| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIXIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001