<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP71-372939 SP71-372939 Spain 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, E35D, M36I, R41K, K45R, R57K, L63T, E65D, H69K, L89M  
>SP71-372939| codons 4-99
TLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYDQIT
IDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, K122P, I142V, K173S, D177E, V189I, T200A, Q207E, R211K, P243S, V245H  
>SP71-372939| codons 40-247
EMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRSQNPEIVIYQYMDDLYIGSDLEIGQHRAKIEELREHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQSIHLP

References
Author Title Citation
Yebra, G Clinical differences and viral diversity between newly HIV type 1-diagnosed African and non-African patients in Spain (2005-2007). ARHR, 2009
Holguin, A Increase of non-B subtypes and recombinants among newly diagnosed HIV-1 native Spaniards and immigrants in Spain. Curr HIV Res, 2008